Free shipping on orders over $100  ·  Orders placed by 12:00 PM MT ship the same day (Mon-Fri)    

TB-500 (Thymosin Beta-4) 5mg

$36.99
Bulk Pricing:
Buy in bulk and save
Adding to cart… The item has been added
TB-500 (Thymosin Beta-4) 5MG

Buy 5 for $35.14 each for a 5% discount

Buy 10 for $33.29 each for a 10% discount

 
 
Synonyms 77591-33-4, Timbetasin, 2D5MRE3SSY, timbetasinum, Timbetasina
IUPAC Condensed Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
PubChem CID 16132341
Molecular Weight 4963 g/mol
tb-500 Chemical Structure Depiction
Reference: PubChem
 

 

THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.