Skip to main content
tesamorelin 10mg peptide vial

Tesamorelin 10mg

$74.99
Bulk Pricing:
Buy in bulk and save

Bulk discount rates

Below are the available bulk discount rates for each individual item when you purchase a certain amount

  • Buy 5 - 9 and get 5% off
  • Buy 10 or above and get 10% off

Tesamorelin 10mg

Buy 5 for $71.24 each for a 5% discount

Buy 10 for $67.49 each for a 10% discount

 

Synonyms Tesamorelin, 218949-48-5, TH9507, MQG94M5EEO, DTXSID00583207

IUPAC Condensed Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
PubChem CID 16137828
CAS Number 901758-09-6
Molecular Weight 5136g/mol
Molecular Formula C221H366N72O67S

tesamorelin peptide Chemical Structure Depiction

Reference: PubChem 

 

How to Reconstitute Peptides

How to Store Peptides

 
THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.
!