Skip to main content

Cagrilintide 5mg

$84.00
Bulk Pricing:
Buy in bulk and save
Adding to cart… The item has been added

Cagrilintide 5MG

Buy 5 for $79.80 each for a 5% discount

Buy 10 for $75.60 each for a 10% discount

 

Synonyms 1415456-99-3, Cagrilintide [INN], RefChem:573322, AO43BIF1U8

Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
PubChem CID
171397054
CAS Number
1415456-99-3
Molecular Weight
4409g/mol
Molecular Formula
C194H312N54O59S2

cagrilintide peptide structure

Source: PubChem

 

How to Reconstitute Peptides

How to Store Peptides

 

THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.