Cagrilintide 5MG
Buy 5 for $79.80 each for a 5% discount
Buy 10 for $75.60 each for a 10% discount
Synonyms 1415456-99-3, Cagrilintide [INN], RefChem:573322, AO43BIF1U8
Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
PubChem CID 171397054
CAS Number 1415456-99-3
Molecular Weight 4409g/mol
Molecular Formula C194H312N54O59S2

Source: PubChem
THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.