Skip to main content
semaglutide peptide vial

Semaglutide 5MG (GLP-1)

$94.99
Bulk Pricing:
Buy in bulk and save

Bulk discount rates

Below are the available bulk discount rates for each individual item when you purchase a certain amount

  • Buy 5 - 9 and get 5% off
  • Buy 10 or above and get 10% off

Semaglutide 5MG (GLP-1)

Buy 5 for $90.24 each for a 5% discount

Buy 10 for $85.49 each for a 10% discount

 

Synonyms Glucagon Like Peptide 1, GLP 1, DTXCID901772398, 89750-14-1, DTXSID701343589

IUPAC Condensed H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
PubChem CID 16133831
Molecular Weight 3297.6g/mol

semaglutide peptide Chemical Structure

Reference: PubChem

 

How to Reconstitute Peptides

How to Store Peptides

 

THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabled as a drug, food or cosmetic.

!